Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158413::      
Protein information
OMPdb FamilyThe Carbapenem resistance-associated outer membrane protein (carO) Family
Protein descriptionCarbapenem-associated resistance protein
Gene nameName=carO
SpeciesAcinetobacter baumannii
NCBI taxonomy470
Protein sequence

MKVLRVLVTTTALLAAGAAMADEAVVHDSYAFDKNQLIPVGARAEVGTTGYGGALLWQAN
PYVGLALGYNGGDISWSDDLSINGTKYDMDMDNKLAYLNAEIRPWGASTNPWAQGLYVAA
GAAYVDNQYDLTKNVGTNASVEIDGNRFNGGANGVSIAGNLKYDNDIAPYIGFGFAPKFS
KNWGVFGEVGAYYSGNPKVSLASNNDALIGSDGRTLGKTLDDQERKIANDDKYKWLPVGK
VGVNFYW
Sequence length247 AA
FragmentNo
pHHM coverage97.35 %
Cross-references
UniprotQ5DL42
PDB4RLB
EMBLAY684798 | FJ652390 | FJ652392
InterProIPR011250
Signal peptide annotation
Amino acids1-21
Sequence

MKVLRVLVTTTALLAAGAAMA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMOOOMMMMMMMIII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIII
IIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen