Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158176::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe FadL Outer Membrane Protein (FadL) Family
Protein descriptionTodX
Gene nameName=todX
SpeciesPseudomonas putida (Arthrobacter siderocapsulatus)
NCBI taxonomy303
Protein sequence

MKIASVLALPLSGYAFSVHATQVFDLEGYGAISRAMGGTSSSYYTGNAALISNPATLSFA
PDGNQFELGLDVVTTDIKVHDSHGAEPKSSTRSNNRAPYVGPQLSYVAQLDDWRFGAGLF
VSSGLGTEYGSKSFLSQTENGIQTSFDNSSRLIVLRAPIGFSYQATSKLTFGASVDLVWT
SLNLELLLPSSQVGALTAQGNLSGGLVPSLAGFVGTGGAAHFSLSRNSTAGGAVDAVGWG
GRLGLTYKLTDNTVLGAMYNFKTSVGDLEGKATLSAISGDGAVLPLDGDIRVKNFEMPAS
LTLGLAHQFNERWVVAADIKRAYWGDVMDSMNVAFISQLGGIDVALPHRYQDITVASIGT
AYKYNNDLTLRAGYSYAQQALDSELILPVIPAYLKRHVTFGGEYDFDKDSRINLAISFGL
RERVQTPSYLAGTEMLRQSHSQINAVVSYSKNF
Sequence length453 AA
FragmentNo
pHHM coverage97.93 %
Cross-references
UniprotQ51971
PfamPF03349
EMBLU18304
InterProIPR005017 | IPR042117
PIRS53995
Signal peptide annotation
Amino acids1-20
Sequence

MKIASVLALPLSGYAFSVHA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMM
MMIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIMMMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen