Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158112::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe OpcA Family
Protein descriptionOpcA protein
Gene nameName=opc, Synonyms=opcA, ORFNames=COI13_11045, ERS040961_01825, NMA510612_1388
SpeciesNeisseria meningitidis
NCBI taxonomy487
Protein sequence

MKKTVFTCAMIALTGTAAAAQELQTANEFTVHTDLSSISSTRAFLKEKHKAAKHIGVRAD
IPFDANQGIRLEAGFGRSKKNIINLETDENKLGKTKNVKLPTGVPENRIDLYTGYTYTQT
LSDSLNFRVGAGLGFESSKDSIKTTKHTLHSSRQSWLAKVHADLLSQLGNGWYINPWSEV
KFDLNSRYKLNTGVTNLKKDINQKTNGWGFGLGANIGKKLGESASIEAGPFYKQRTYKES
GEFSVTTKSGDVSLTIPKTSIREYGLRVGIKF
Sequence length272 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ51227
PDB1K24
PfamPF07239
EMBLM80195 | CP007524 | AJ242841 | CFME01000069 | NWWY01000041
InterProIPR020080 | IPR009876
PIRA44611 | C81893
Signal peptide annotation
Amino acids1-19
Sequence

MKKTVFTCAMIALTGTAAA
Annotation sourceExperimentally verified
TM annotation
# beta strands10
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMOOOOOOOMMMMMMMMMMMMM
IIIIIIIIMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMIIII
IIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIIIIIIIMMMMM
MMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIIIIIIMMMMMMMMMMMMOO
OOOOOOOOOOOOOOOOOOMMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen