Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158098::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFe-regulated protein B
Gene nameName=frpB
SpeciesNeisseria meningitidis
NCBI taxonomy487
Protein sequence

MNTPLFRLSLLSLTLAAGFAHAAENNAKVVLDTVTVKGDRQGSKIRTNIVTLQQKDESTA
TDMRELLKEEPSIDFGGGNGTSQFLTLRGMGQNSVDIKVDNAYSDSQILYHQGRFIVDPA
LVKVVSVQKGAGSASAGIGATNGAIIAKTVDAQDLLKGLDKNWGVRLNSGFASNEGVSYG
ASVFGKEGNFDGLFSYNRNDEKDYEAGKGFRNVNGGKTVPYSALDKRSYLAKIGTTFGDD
DHRIVLSHMKDQHRGIRTVREEFTVGDKSSRINIDRQAPAYRETTQSNTNLAYTGKNLGF
VEKLDANAYVLEKERYSADDSGTGYAGNVKGPNHTRITTRGANFNFDSRLAEQTLLKYGI
NYRHQEIKPQAFLNSKFSIPTTEEKNGQKVDKPMEQQMKDRADEDTVHAYKLSNPTKTDT
GVYVEAIHDIGDFTLTGGLRYDRFKVKTHDGKTVSSSNLNPSFGVIWQPHEHWSFSASHN
YASRSPRLYDALQTHGKRGIISIADGTKAERARNTEIGFNYNDGTFAANGSYFWQTIKDA
LANPQNRHDSVAVREAVNAGYIKNHGYELGASYRTGGLTAKVGVSHSKPRFYDTHKDKLL
SANPEFGAQVGRTWTASLAYRFQNPNLEIGWRGRYVQKATGSILAAGQKDRKGNLENVVR
KGFGVNDVFANWKPLGKDTLNVNLSVNNVFNKFYYPHSQRWTNTLPGVGRDVRLGVNYKF
Sequence length720 AA
FragmentNo
pHHM coverage85.13 %
Cross-references
UniprotQ51162
PDB4AIP
PfamPF07715 | PF00593
EMBLX89755
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR036942 | IPR010917 | IPR010105
PROSITEPS01156
PIRS58133
Signal peptide annotation
Amino acids1-22
Sequence

MNTPLFRLSLLSLTLAAGFAHA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOMMMM
MMMMMIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIII
IMMMMMMMOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIM
MMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMM
MMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OMMMMMMMMMIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMM
MOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIMMMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMMMMIIIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability0.93
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen