Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1158070::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionPorin (PorB)
Gene nameName=porB
SpeciesNeisseria gonorrhoeae
NCBI taxonomy485
Protein sequence

MKKSLIALTLAALPVAAMADVTLYGTIKAGVETSRSVAHHGAQADRVKTATEIADLGSKI
GFKGQEDLGNGLKAIWQLEQKAYVSGTDTGWGNRQSFIGLKGGFGKVRVGRLNNILKDTG
GFNPWEGKSYYSGLSNIAQPEERHVSVRYDSPEFAGFSGSVQYVPNDNSGKNRSESYHAG
FNYKNSGFFVQYAGSYKRHNYTTEKHQVHRLVGGYDHDALYASVAVQQQDAKLTWRDDNS
HNSQTEVATTVAYRFGNVTPRVSYAHGFKGSVYDADHDNTYDQVVVGAEYDFSKRTSALV
SAGWLQKGKGAEKFVATVGGVGLRHKF
Sequence length327 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ51056
PDB4AUI
PfamPF00267
EMBLZ69259
InterProIPR033900 | IPR023614 | IPR001702 | IPR013793 | IPR002299
PROSITEPS00576
PRINTSPR00182 | PR00184
Signal peptide annotation
Amino acids1-19
Sequence

MKKSLIALTLAALPVAAMA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMIIMMMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOOOMMM
MMMMIIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMOOOOOOOOOOOOOO
OOOOOOMMMMMMMIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMM
MMMOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen