Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1157520::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOuter membrane protein X
Gene nameSK89_01045
SpeciesKlebsiella pneumoniae
NCBI taxonomy573
Protein sequence

MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKIDGLHYFSDDKDVDGDQTYMRLG
VKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVY
DVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSG
EGATNNGRGALKQNGDGFGTSVTYDIFDGISAGFAYANSKRTDDQNQLLLGEGDHAETYT
GGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVAAQYQFDFGLRPSVAYLQSKG
KDLNGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRSAGISTDDVVALGLV
YQF
Sequence length363 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ48473
PDB1OSM
PfamPF00267
EMBLZ33506
InterProIPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
PIRS51104
Signal peptide annotation
Amino acids1-21
Sequence

MKVKVLSLLVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMM
MMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen