Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1157506::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Cyclodextrin Porin (CymA) Family
Protein descriptionCymA protein
Gene nameName=cymA
SpeciesKlebsiella oxytoca
NCBI taxonomy571
Protein sequence

MKKKLLSASIALALTAPVHSFAASDQRGYKPEDVAFDESFFSFGGHVGTSVEYEDKVTRG
FNNTDKKEKTITNEVFNFFYNNPQWNFMGFYSFKIENREQKEPGYYENEDGIKQLFSLNK
GHDLGNGWATGLIYELEYTRSKVYSPDVSGLRKNLAEHSIRPYLTYWNNDYNMGFYSNLE
YLLSKEDRNAWGKRQEQGYSALFKPYKRFGNWEVGVEFYYQIKTNDEKQPDGTINEKSDF
NERYIEPIVQYSFDDAGTLYTRVRVGKNETKNTDRSGGGNAGINYFKDIRKATVGYEQSI
GESWVAKAEYEYANEVEKKSRLSGWEARNKSELTQHTFYAQALYRF
Sequence length346 AA
FragmentNo
pHHM coverage99.71 %
Cross-references
UniprotQ48391
PDB4D51 | 4D5B | 4D5D | 4V3G | 4V3H
PfamPF16941
EMBLX86014
InterProIPR031609 | IPR011250
PIRS63618
Signal peptide annotation
Amino acids1-21
Sequence

MKKKLLSASIALALTAPVHSF
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMOOOO
OOOOOOOOMMMMMMMMMMMMMIIIIIMMMMMMMMMMMMOOOOOOOOOOOMMMMMMMMMMM
MIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIIIIMMMMMM
MMMMMOOOOOOOOOOMMMMMMMMMMMIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOM
MMMMMMMMMMIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMII
IIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen