Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1157075::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Two-Partner Secretion (TPS) Family
Protein descriptionOuter membrane transporter CdiB
Gene nameName=cdiB
SpeciesEscherichia coli
NCBI taxonomy562
Protein sequence

MRHRQDNLLANRTLLPGMASGQYVFRLCTFSPVVRYFSLLPCLCILSFSSPAAMLSPGDR
SAIQQQQQQLLDENQRQRDALERSAPLTITPSPETSAGTEGPCFTVSSIVVSGATRLTSA
ETDRLVAPWVNQCLNITGLTAVTDAMTDSYIRRGYITSRAFLTEQDLSGGVLHITVMEGR
LQQIRAEGADLPARTLKMVFPGMEGKVLNLRDIEQGMEQINRLRTEPVQIEISPGDREGW
SVVTLTALPEWPVTGSVGIDNSGQKSTGTGQLNGVLSFNNPLGLADNWFVSGGRSSDFSV
SHDARNFAAGVSLPYGYTLVDYTYSWSDYLSTIDNRGWRWRSTGDLQTHRLGLSHVLFRN
GDMKTALTGGLQHRIIHNYLDDVLLQGSSRKLTSFSVGLNHTHKFLGGVGTLNPVFTRGM
PWFGAESDHGKRGDLPVNQFRKWSVSASFQRPVTDRVWWLTSAYAQWSPDRLHGVEQLSL
GGESSVRGFKDQYISGNNGGYLRNELSWSLFSLPYVGTVRAVAALDGGWLHSDSDDPYSS
GTLWGAAAGLSTTSGHVSGSFTAGLPLVYPDWLAPDHLTVYWRVAVAF
Sequence length588 AA
FragmentNo
pHHM coverage99.68 %
Cross-references
UniprotQ3YL97
PfamPF08479 | PF17287 | PF03865
EMBLDQ100454
InterProIPR005565 | IPR013686 | IPR034746 | IPR035251 | IPR027282
PROSITEPS51779
Signal peptide annotation
No information available
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIMMMMMMMMOOOOOOOMMMMMMMMIIIIIIIIIIMMMMMMMMOOOOO
OOOOMMMMMMMMIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIII
IIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIMMMMMMMMMM
MOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMMMOOOOOOOOOOOO
OOOMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOMMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen