Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151677::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Opacity Family
Protein descriptionAil/Lom family outer membrane beta-barrel protein
Gene nameZZ79_21445
SpeciesNeisseria gonorrhoeae
NCBI taxonomy485
Protein sequence

ASEDGGRGPYVQADLAYAYEHITHDYPEPTAPNKNKISTVSDYFRNIRTRSVHPRVSVGY
DFGGWRIAADYARYRKWNNNKYSVNIENVRIRKENGIRIDRKTENQENGTFHAVSSLGLS
AIYDFQINDKFKPYIGARVAYGHVRHSIDSTKKTIEVTTVPSNAPNGAVTTYNTDPKTQN
DYQSNSIRRVGLGVIAGVGFDITPKLTLDAGYRYHNWGRLENTRFKTHEASLGVRYRF
Sequence length238 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ04884
PDB2MAF | 2MLH
PfamPF02462
EMBLZ18939 | X60711
InterProIPR006315 | IPR011250 | IPR003394
PIRS16619
Signal peptide annotation
No information available
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOMMMMMMMMMMMMM
IIIIIMMMMMMMMMMMMMOOOOOOOOOOMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM
MMMIIIIIIIIIMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMOOOOOOO
OOOOMMMMMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMMMOOMMMMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen