Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151529::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe OmpW Family
Protein descriptionLong-chain fatty acid outer membrane transporter
Gene nameORFNames=NCTC13377_00650
SpeciesPseudomonas oleovorans
NCBI taxonomy301
Protein sequence

MSFSNYKVIAMPVLVANFVLGAATAWANENYPAKSAGYNQGDWVASFNFSKVYVGEELGD
LNVGGGALPNADVSIGNDTTLTFDIAYFVSSNIAVDFFVGVPARAKFQGEKSISSLGRVS
EVDYGPAILSLQYHYDSFERLYPYVGVGVGRVLFFDKTDGALSSFDIKDKWAPAFQVGLR
YDLGNSWMLNSDVRYIPFKTDVTGTLGPVPVSTKIEVDPFILSLGASYVF
Sequence length230 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotQ00595
PDB6QAM | 6QWR
PfamPF03922
EMBLAJ245436
InterProIPR011250 | IPR005618
PIRS27996
Signal peptide annotation
Amino acids1-27
Sequence

MSFSNYKVIAMPVLVANFVLGAATAWA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOO
OOOMMMMMMMMMMMIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMMMMM
MMMIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen