Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151435::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionOuter membrane heme receptor ShuA
Gene nameName=shuA, ORFNames=NCTC4837_05545
SpeciesShigella dysenteriae
NCBI taxonomy622
Protein sequence

MSRPQFTSLRLSLLALAVSATLPTFAFATETMTVTATGNARSSFEAPMMVSVIDTSAPEN
QTATSATDLLRHVPGITLDGTGRTNGQDINMRGYDHRGVLVLVDGIRQGTDTGHLNGTFL
DPALIKRVEIVRGPSALLYGSGALGGVISYDTVDAKDLLQEGQSSGFRVFGTGGTGDHSL
GLGASAFGRTENLDGIVAWSSRDRGDLRQSNGETAPNDESINNMLAKGTWQIDSAQSLSG
LVRYYNNDAREPKNPQTVEASESSNPMVDRSTIQRDAQLSYKLAPQGNDWLNADAKIYWS
EVRINAQNTGSSGEYREQITKGARLENRSTLFADSFASHLLTYGGEYYRQEQHPGGATTG
FPQAKIDFSSGWLQDEITLRDLPITLLGGTRYDSYRGSSDGYKDVDADKWSSRAGMTINP
TNWLMLFGSYAQAFRAPTMGEMYNDSKHFSIGRFYTNYWVPNPNLRPETNETQEYGFGLR
FDDLMLSNDALEFKASYFDTKAKDYISTTVDFAAATTMSYNVPNAKIWGWDVMTKYTTDL
FSLDVAYNRTRGKDTDTGEYISSINPDTVTSTLNIPIAHSGFSVGWVGTFADRSTHISSS
YSKQPGYGVNDFYVSYQGQQALKGMTTTLVLGNAFDKEYWSPQGIPQDGRNGKIFVSYQW
Sequence length660 AA
FragmentNo
pHHM coverage99.61 %
Cross-references
UniprotP72412
PDB3FHH
PfamPF07715 | PF00593
EMBLU64516 | UAUQ01000017
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR010916 | IPR011276 | IPR010949 | IPR036942
PROSITEPS00430
Signal peptide annotation
Amino acids1-28
Sequence

MSRPQFTSLRLSLLALAVSATLPTFAFA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIII
MMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMMMMMMMMMMMMMMMMMMIIIIIIIIMMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIMMMMMMMO
OOOOOOOOOOOOOOOOOOOOOMMMIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOMMMMMMMMIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMII
IIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMM
MIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIII
MMMMMMOOOOOOOOOOOOOOOOOOOOOOMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOO
OOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen