Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151418::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe PgaA Family
Protein descriptionOuter membrane protein OmpK
Gene nameName=ompA, OrderedLocusNames=BU332
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MYSSSRKRCPKTKWALKLLTAAFLAASPAAKSAVNNAYDALIIEARKGNTQPALSWFALK
SALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTL
WQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGR
HQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSF
MPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISH
YQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFY
SHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQA
EMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTAL
TLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDV
DLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWRSRNIWLEAEYAERVF
NHEHKPGARLSGWYDFNDNWRIGSQLERLSHRVPLRAMKNGVTGNSAQAYVRWYQNERRK
YGVSWAFTDFSDSNQRHEVSLEGQERIWSSPYLIVDFLPSLYYEQNTEHDTPYYNPIKTF
DIVPAFEASHLLWRSYENSWEQIFSAGVGASWQKHYGTDVVTQLGYGQRISWNDVIDAGA
TLRWEKRPYDGDREHNLYVEFDMTFRF
Sequence length807 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP69434
PDB4Y25
EMBLU00096 | AP009048
InterProIPR023870 | IPR013026 | IPR011990 | IPR019734
SMARTSM00028
PROSITEPS50005 | PS50293
PIRF64844
Signal peptide annotation
Amino acids1-26
Sequence

MYSSSRKRCPKTKWALKLLTAAFLAA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOOMMM
MMMMMMMIIIIIIIIMMMMMMMMMMOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMMMMOO
OOOOOOMMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIM
MMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOO
MMMMMMMMIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOMMMMMMMMMIIIIIIIIIIMM
MMMMMMMOOOOOOOMMMMMMMMMIIII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen