Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151386::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionOuter membrane protein assembly factor BamA
Gene nameName=bamA
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MPAPHGLSPLSKAFLMRRAFQRRILPHSLAMALSLPLAGYVQAQEVEFDIPPQALGSALQ
EFGRQADIQVLYRPEEVRNKRSSAIKGKLEPNQAITELLRGTGASVDFQGNAITISVAEA
ADSSVDLGATMITSNQLGTITEDSGSYTPGTIATATRLVLTPRETPQSITVVTRQNMDDF
GLNNIDDVMRHTPGITVSAYDTDRNNYYARGFSINNFQYDGIPSTARNVGYSAGNTLSDM
AIYDRVEVLKGATGLLTGAGSLGATINLIRKKPTHEFKGHVELGAGSWDNYRSELDVSGP
LTESGNVRGRAVAAYQDKHSFMDHYERKTSVYYGILEFDLNPDTMLTVGADYQDNDPKGS
GWSGSFPLFDSQGNRNDVSRSFNNGAKWSSWEQYTRTVFANLEHNFANGWVGKVQLDHKI
NGYHAPLGAIMGDWPAPDNSAKIVAQKYTGETKSNSLDIYLTGPFQFLGREHELVVGTSA
SFSHWEGKSYWNLRNYDNTTDDFINWDGDIGKPDWGTPSQYIDDKTRQLGSYMTARFNVT
DDLNLFLGGRVVDYRVTGLNPTIRESGRFIPYVGAVYDLNDTYSVYASYTDIFMPQDSWY
RDSSNKLLEPDEGQNYEIGIKGEYLDGRLNTSLAYFEIHEENRAEEDALYNSKPTNPAIT
YAYKGIKAKTKGYEAEISGELAPGWQVQAGYTHKIIRDDSGKKVSTWEPQDQLSLYTSYK
FKGALDKLTVGGGARWQGKSWQMVYNNPRSRWEKFSQEDYWLVDLMARYQITDKLSASVN
VNNVFDKTYYTNIGFYTSASYGDPRNLMFSTRWDF
Sequence length815 AA
FragmentNo
pHHM coverage90.02 %
Cross-references
UniprotP48632
PDB1XKH | 2IAH | 2O5P | 2W16 | 2W6T | 2W6U | 2W75 | 2W76 | 2W77 | 2W78 | 5ODW
PfamPF07715 | PF07660 | PF00593
EMBLL10210 | U07359 | AE004091
InterProIPR012910 | IPR037066 | IPR011662 | IPR039423 | IPR000531 | IPR036942 | IPR010917 | IPR010105
SMARTSM00965
PROSITEPS01156
PIRA40601 | H83345
Signal peptide annotation
Amino acids1-43
Sequence

MPAPHGLSPLSKAFLMRRAFQRRILPHSLAMALSLPLAGYVQA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOO
OOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMIIIIIIIMMMMMMM
MOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIIIIIMMMMMMMM
MMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIII
IIMMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMI
IIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMM
MMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen