Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151384::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionOuter membrane protein assembly factor BamA
Gene nameName=bamA
SpeciesYersinia pestis
NCBI taxonomy632
Protein sequence

MKMTRLYPLALGGLLLPAIANAQTSQQDESTLVVTASKQSSRSASANNVSSTVVSAPELS
DAGVTASDKLPRVLPGLNIENSGNMLFSTISLRGVSSAQDFYNPAVTLYVDGVPQLSTNT
IQALTDVQSVELLRGPQGTLYGKSAQGGIINIVTQQPDSTPRGYIEGGVSSRDSYRSKFN
LSGPIQDGLLYGSVTLLRQVDDGDMINPATGSDDLGGTRASIGNVKLRLAPDDQPWEMGF
AASRECTRATQDAYVGWNDIKGRKLSISDGSPDPYMRRCTDSQTLSGKYTTDDWVFNLIS
AWQQQHYSRTFPSGSLIVNMPQRWNQDVQELRAATLGDARTVDMVFGLYRQNTREKLNSA
YDMPTMPYLSSTGYTTAETLAAYSDLTWHLTDRFDIGGGVRFSHDKSSTQYHGSMLGNPF
GDQGKSNDDQVLGQLSAGYMLTDDWRVYTRVAQGYKPSGYNIVPTAGLDAKPFVAEKSIN
YELGTRYETADVTLQAATFYTHTKDMQLYSGPVRMQTLSNAGKADATGVELEAKWRFAPG
WSWDINGNVIRSEFTNDSELYHGNRVPFVPRYGAGSSVNGVIDTRYGALMPRLAVNLVGP
HYFDGDNQLRQGTYATLDSSLGWQATERMNISVYVDNLFDRRYRTYGYMNGSSAVAQVNM
GRTVGINTRIDFF
Sequence length673 AA
FragmentNo
pHHM coverage90.02 %
Cross-references
UniprotP46359
PDB4EPA
PfamPF07715 | PF00593
EMBLZ35104 | U09530 | AF091251 | AL031866 | AL590842 | AE009952 | AE017042
InterProIPR039426 | IPR012910 | IPR000531 | IPR036942 | IPR010105
PIRA56148 | AF0232
Signal peptide annotation
Amino acids1-22
Sequence

MKMTRLYPLALGGLLLPAIANA
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIMMMMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMMMMMIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMMIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIII
MMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMMMM
MOOOOOOOOOOOMMMMMMMIMMMMMMMOMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIII
Annotation reliability0.86
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen