Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151342::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Intimin/Invasin Family
Protein descriptionNucleoside-specific channel-forming protein Tsx
Gene nameName=tsx
SpeciesEscherichia coli O157:H7
NCBI taxonomy83334
Protein sequence

MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYFKLGSDSKLLTHDSYQ
NRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKAAPGQQIILPLKKLPFE
YSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKALNYAAQQAASLGSQLQSR
SLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKM
LAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYF
KSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVAL
FNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIE
PQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNIPHDINGTEHSTQKIQLIVKSKY
GLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAYVQGGSNIYKVTARAYDRNGNSSN
NVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNADTITYTATVKKNGVAQANVPVSFNI
VSGTATLGANSAKTDANGKATVTLKSSTPGQVVVSAKTAEMTSALNASAVIFFDQTKASI
TEIKADKTTAVANGKDAIKYTVKVMKNGQPVNNQSVTFSTNFGMFNGKSQTQATTGNDGR
ATITLTSSSAGKATVSATVSDGAEVKATEVTFFDELKIDNKVDIIGNNVRGELPNIWLQY
GQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPS
YMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSS
EQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE
Sequence length934 AA
FragmentNo
pHHM coverage99.28 %
Cross-references
UniprotP43261
PDB2ZQK | 2ZWK | 3NCW | 3NCX | 4E1S | 5G26
PfamPF02369 | PF02368 | PF11924 | PF07979 | PF01476
EMBLZ11541 | X60439 | AF071034 | AF081182 | AF081183 | AE005174 | BA000007 | U32312 | L08095
InterProIPR003344 | IPR003343 | IPR016186 | IPR016187 | IPR024519 | IPR038177 | IPR013783 | IPR003535 | IPR013117 | IPR008964 | IPR018392
SMARTSM00634 | SM00635 | SM00257
PROSITEPS51127 | PS51782
PRINTSPR01369
PIRC86045 | G91198 | I41193
Signal peptide annotation
Amino acids1-38
Sequence

MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSF
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands12
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMOOOOOOMMMMMMMMIIIIIIII
IMMMMMMMMOOOOOOOMMMMMMMMIIIIIIIMMMMMMMOOOOOOOOOOOMMMMMMMIIIM
MMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIMMMMMMMOOOOOOOOOOMMMMMMMMIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen