Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151340::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionNucleoside-specific channel-forming protein Tsx
Gene nameName=tsx
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MKTETKVIKGRQGIARNRHTPLCLGLLLALSPLAAAVADARKDGETELPDMVISGESTSA
TQPPGVTTLGKVPLKPRELPQSASVIDHERLEQQNLFSLDEAMQQATGVTVQPFQLLTTA
YYVRGFKVDSFELDGVPALLGNTASSPQDMAIYERVEILRGSNGLLHGTGNPAATVNLVR
KRPQREFAASTTLSAGRWDRYRAEVDVGGPLSASGNVRGRAVAAYEDRDYFYDVADQGTR
LLYGVTEFDLSPDTLLTVGAQYQHIDSITNMAGVPMAKDGSNLGLSRDTYLDVDWDRFKW
DTYRAFGSLEQQLGGGWKGKVSAEYQEADSRLRYAGSFGAIDPQTGDGGQLMGAAYKFKS
IQRSLDANLNGPVRLFGLTHELLGGVTYAQGETRQDTARFLNLPNTPVNVYRWDPHGVPR
PQIGQYTSPGTTTTTQKGLYALGRIKLAEPLTLVVGGRESWWDQDTPATRFKPGRQFTPY
GGLIWDFARDWSWYVSYAEVYQPQADRQTWNSEPLSPVEGKTYETGIKGELADGRLNLSL
AAFRIDLENNPQEDPDHPGPPNNPFYISGGKVRSQGFELEGTGYLTPYWSLSAGYTYTST
EYLKDSQNDSGTRYSTFTPRHLLRLWSNYDLPWQDRRWSVGGGLQAQSDYSVDYRGVSMR
QGGYALVNMRLGYKIDEHWTAAVNVNNLFDRTYYQSLSNPNWNNRYGEPRSFNVSLRGAF
Sequence length720 AA
FragmentNo
pHHM coverage88.26 %
Cross-references
UniprotP42512
PDB1XKW
PfamPF07715 | PF00593
EMBLU03161 | AE004091
InterProIPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR036942 | IPR010917 | IPR010105
PROSITEPS01156
PIRA36942
Signal peptide annotation
Amino acids1-38
Sequence

MKTETKVIKGRQGIARNRHTPLCLGLLLALSPLAAAVA
Annotation sourceExperimentally verified
TM annotation
# beta strands20
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOOO
OOMMMMMMMMMMMIIIMMMMMMMMMOOOOOOMMMMMMMMMIIIIIIIMMMMMMMMMOOOO
OOOOMMMMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMMMMOOOOOOOOOOOOOOOMMMM
MMMMMMMIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIMMMMM
MMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIMMMMMMMMMOOO
OOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOO
OOMMMMMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability0.94
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen