Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151314::      
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionVitamin B12 transporter BtuB
Gene nameName=btuB, OrderedLocusNames=STM4130
SpeciesSalmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NCBI taxonomy99287
Protein sequence

MMKRKILAAVIPALLAAATANAAEIYNKDGNKLDLYGKAVGRHVWTTTGDSKNADQTYAQ
IGFKGETQINTDLTGFGQWEYRTKADRAEGEQQNSNLVRLAFAGLKYAEVGSIDYGRNYG
IVYDVESYTDMAPYFSGETWGGAYTDNYMTSRAGGLLTYRNSDFFGLVDGLSFGIQYQGK
NQDNHSINSQNGDGVGYTMAYEFDGFGVTAAYSNSKRTNDQQDRDGNGDRAESWAVGAKY
DANNVYLAAVYAETRNMSIVENTVTDTVEMANKTQNLEVVAQYQFDFGLRPAISYVQSKG
KQLNGAGGSADLAKYIQAGATYYFNKNMNVWVDYRFNLLDENDYSSSYVGTDDQAAVGIT
YQF
Sequence length363 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP37432
PDB3NSG | 4KR4 | 4KR8 | 4KRA
PfamPF00267
EMBLZ31594 | AE006468
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
PIRS43159
Signal peptide annotation
Amino acids1-22
Sequence

MMKRKILAAVIPALLAAATANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOM
MMMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOMMMMMMMIIIMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMM
MIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOO
OOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOMMMMMM
MMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen