Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151312::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Antimicrobial peptide resistance and lipid A acylation protein (PagP) Family
Protein descriptionLipid A palmitoyltransferase PagP
Gene nameName=pagP, Synonyms=crcA, Synonyms=crcA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIAQTWQQPEHYDLYIPAITWHAR
FAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRP
LADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFA
WMRFQF
Sequence length186 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP37001
PDB1MM4 | 1MM5 | 1THQ | 3GP6
PfamPF07017
EMBLS83396 | D28497 | L29054 | U82598 | U00096 | AP009048
InterProIPR011250 | IPR009746
PIRD64796
Signal peptide annotation
Amino acids1-25
Sequence

MNVSKYVAIFSFVFIQLISVGKVFA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOO
OOOOOOOOOOOOOMMMMMMMMMIIIIIIIIIIMMMMMMMOOOOOOOMMMMMMMMMIIIII
IIIIIIIIMMMMMMMMMMOOOOOOMMMMMMMMMMMMMIIIMMMMMMMMMOOOOOOMMMMM
MMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen