Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151293::      
Protein information
OMPdb FamilyThe Outer Membrane Porin (OprD) Family
Protein descriptionBacteriophage adsorption protein A
Gene nameName=lptD, Synonyms=impostAyabG
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MKVMKWSAIALAVSAGSTQFAVADAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDGKSGSG
DRVDWTQGFLTTYESGFTQGTVGFGVDAFGYLGLKLDGTSDKTGTGNLPVMNDGKPRDDY
SRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTATGFQLQSSEFEGLDLEAGHF
TEGKEPTTVKSRGELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNS
NYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGD
QPFDYIGFGRNGSGAGGDSIFLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVR
YINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYVVQSGPAKDLSFRIRQAWHRA
NADQGEGDQNEFRLIVDYPLSIL
Sequence length443 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP32722
PDB2ODJ | 3SY7 | 4FOZ
PfamPF03573
EMBLX63152 | Z14065 | AE004091
InterProIPR005318 | IPR023614
PIRS23771
Signal peptide annotation
Amino acids1-23
Sequence

MKVMKWSAIALAVSAGSTQFAVA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOO
OOOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMOOOOOOOMMMMMM
MMIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIIMMMMMMMMOOOO
OOOOOOOOOOOMMMMMMMMMIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen