Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151275::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOuter membrane protein A
Gene nameName=lamBSynonyms=malL
SpeciesNeisseria meningitidis serogroup B (strain MC58)
NCBI taxonomy122586
Protein sequence

MKKSLIALTLAALPVAAMADVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKI
GFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTG
DINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAG
FNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTD
ASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRT
SALVSAGWLQEGKGENKFVATAGGVGLRHKF
Sequence length331 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP30690
PDB3WI4 | 3WI5
PfamPF00267
EMBLX65532 | AE002098
InterProIPR033900 | IPR023614 | IPR001702 | IPR013793 | IPR002299
PROSITEPS00576
PRINTSPR00182 | PR00184
PIRS21407
Signal peptide annotation
Amino acids1-19
Sequence

MKKSLIALTLAALPVAAMA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMIIMMMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOOOMMM
MMMMIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMOOOOOOOOO
OOOOOOOOOOMMMMMMMIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIM
MMMMMMMOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen