Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151271::      
Protein information
OMPdb FamilyThe Outer Membrane Fimbrial Usher Porin (FUP) Family
Protein descriptionOuter membrane protein A
Gene nameName=lamBSynonyms=malL
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MSYLNLRLYQRNTQCLHIRKHRLAGFFVRLVVACAFAAQAPLSSADLYFNPRFLADDPQA
VADLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLN
TASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDP
GINAGLLNYNFSGNSVQNRIGGNSHYAYLNLQSGLNIGAWRLRDNTTWSYNSSDRSSGSK
NKWQHINTWLERDIIPLRSRLTLGDGYTQGDIFDGINFRGAQLASDDNMLPDSQRGFAPV
IHGIARGTAQVTIKQNGYDIYNSTVPPGPFTINDIYAAGNSGDLQVTIKEADGSTQIFTV
PYSSVPLLQREGHTRYSITAGEYRSGNAQQEKTRFFQSTLLHGLPAGWTIYGGTQLADRY
RAFNFGIGKNMGALGALSVDMTQANSTLPDDSQHDGQSVRFLYNKSLNESGTNIQLVGYR
YSTSGYFNFADTTYSRMNGYNIETQDGVIQVKPKFTDYYNLAYNKRGKLQLTVTQQLGRT
STLYLSGSHQTYWGTSNVDEQFQAGLNTAFEDINWTLSYSLTKNAWQKGRDQMLALNVNI
PFSHWLRSDSKSQWRHASASYSMSHDLNGRMTNLAGVYGTLLEDNNLSYSVQTGYAGGGD
GNSGSTGYATLNYRGGYGNANIGYSHSDDIKQLYYGVSGGVLAHANGVTLGQPLNDTVVL
VKAPGAKDAKVENQTGVRTDWRGYAVLPYATEYRENRVALDTNTLADNVDLDNAVANVVP
TRGAIVRAEFKARVGIKLLMTLTHNNKPLPFGAMVTSESSQSSGIVADNGQVYLSGMPLA
GKVQVKWGEEENAHCVANYQLPPESQQQLLTQLSAECR
Sequence length878 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP30130
PDB1ZDV | 1ZDX | 1ZE3 | 3BWU | 3OHN | 3RFZ | 4J3O | 6E14 | 6E15
PfamPF13953 | PF13954 | PF00577
EMBLX51655 | U14003 | U00096 | AP009048
InterProIPR000015 | IPR018030 | IPR042186 | IPR025949 | IPR043142 | IPR025885 | IPR037224
PROSITEPS01151
PIRS56542
Signal peptide annotation
Amino acids1-45
Sequence

MSYLNLRLYQRNTQCLHIRKHRLAGFFVRLVVACAFAAQAPLSSA
Annotation sourceExperimentally verified
TM annotation
# beta strands24
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIMMMMMMMOOOOOOOOOOOOMMMMMMMMIIIIIIIIIMMMMOOOOOOOOOOOOOO
OOOMMMMMMMIIIIIIIIIIIMMMMMMOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOO
OOMMMMMMMIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMIIIIIIIIMMMMMMO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMIIIII
IMMMMMMOOOOOOOOOOOOOMMMMMMIIIIIIIIIMMMMMMOOOOOOOOOOOOOMMMMMM
IIIIIIIIIIIIIIIIIMMMMMMOOOOOOOOOOOMMMMMIIIIIIIIIMMMMMOOOOOOO
OOOOOOMMMMMMIIIIIIIMMMMMMOOOOOOOMMMMMMIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen