Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151264::      
Protein information
OMPdb FamilyThe Sugar Porin (SP) Family
Protein descriptionOuter membrane protein A
Gene nameName=lamBSynonyms=malL, Name=lamBSynonyms=malL
SpeciesSalmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
NCBI taxonomy99287
Protein sequence

MMITLRKLPLAVAVAAGVMSAQAMAVDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLG
NECETYAELKLGQEVWKEGDKSFYFDTNVAYSVNQQNDWESTDPAFREANVQGKNLIEWL
PGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTF
SSQNIYDEVKDTANDVFDVRLAGLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMF
TAEHTQSMLKGYNKFVVQYATDAMTTQGKGQARGSDGSSSFTEELSDGTKINYANKVINN
NGNMWRILDHGAISLGDKWDLMYVGMYQNIDWDNNLGTEWWTVGVRPMYKWTPIMSTLLE
VGYDNVKSQQTGDRNNQYKITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNI
SRYAAATNSGISTNSRGDSDEWTFGAQMEIWW
Sequence length452 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP26466
PDB1MPR | 2MPR
PfamPF02264
EMBLX54292 | AE006468
InterProIPR023738 | IPR003192 | IPR036998
PIRA60177
Signal peptide annotation
Amino acids1-25
Sequence

MMITLRKLPLAVAVAAGVMSAQAMA
Annotation sourceExperimentally verified
TM annotation
# beta strands18
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMMMIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMMI
IIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIMMMMMMMMM
OOOOOOOOOOOOOOOOMMMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOMMM
MMMMMMMMIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOMMMMMMMMMMMIIIMMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMIIIMMMMMM
MMMOOOOOOOOOOOOOOMMMMMMMMMIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMM
Annotation reliability0.91
Annotation sourcePrediction [PRED-TMBB2]


Elixir UTH dib compgen