Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151259::      
Protein information
OMPdb FamilyThe TOM40 Family
Protein descriptionOuter membrane protein A
Gene nameName=ompA
SpeciesNeurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 /FGSC 987)
NCBI taxonomy367110
Protein sequence

MASFSTESPLAMLRDNAIYSSLSDAFNAFQERRKQFGLSNPGTIETIAREVQRDTLLTNY
MFSGLRADVTKAFSLAPLFQVSHQFAMGERLNPYAFAALYGTNQIFAQGNLDNEGALSTR
FNYRWGDRTITKTQFSIGGGQDMAQFEHEHLGDDFSASLKAINPSFLDGGLTGIFVGDYL
QAVTPRLGLGLQAVWQRQGLTQGPDTAISYFARYKAGDWVASAQLQAQGALNTSFWKKLT
DRVQAGVDMTLSVAPSQSMMGGLTKEGITTFGAKYDFRMSTFRAQIDSKGKLSCLLEKRL
GAAPVTLTFAADVDHVTQQAKLGMSVSIEASDVDLQEQQEGAQSLNIPF
Sequence length349 AA
FragmentNo
pHHM coverage99.69 %
Cross-references
UniprotP24391
PDB5O8O
PfamPF01459
EMBLX56883 | AL670010 | CM002240
InterProIPR023614 | IPR027246 | IPR037930 | IPR005686
PIRS13418
Signal peptide annotation
No information available
TM annotation
# beta strands19
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIMMMMMMMMOOOOOMMMMMMMIIIIIIIMMMMMMMOOOOOMMMMMMMIIIIIIMM
MMMMMOOOOOMMMMMMIIIIIIMMMMMMMMOOOOOMMMMMMMMMIIIIIIIIIMMMMMMM
MOOOOOOMMMMMMMMIIIIIIIIIIIMMMMMMMMMOOOMMMMMMMMMIIIMMMMMMMMMO
OOMMMMMMMMIIIIIIIIIIIIIIIIIIMMMMMMMMOOOMMMMMMMMIIIIIMMMMMMMM
OOOMMMMMMMMIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOO
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen