Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151246::      
Protein information
OMPdb FamilyThe VDAC Family
Protein descriptionMitochondrial distribution and morphology protein 10
Gene nameName=MDM10, OrderedLocusNames=YAL010C
SpeciesHomo sapiens (Human)
NCBI taxonomy9606
Protein sequence

MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Sequence length283 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP21796
PDB2JK4 | 2K4T | 5JDP | 5XDN | 5XDO | 6G6U | 6G73 | 6TIQ | 6TIR
PfamPF01459
EMBLL06132 | AJ250032 | AJ250033 | AJ250034 | AJ250035 | AJ250036 | AJ250037 | AJ250038 | AJ250039 | AF151097 | AF151093 | AF151094 | AF151095 | AF151096 | AC005200 | AK122953 | AC008608 | CH471062 | BC008482 | BC071168 | BC090042
InterProIPR023614 | IPR001925 | IPR027246 | IPR030270
PROSITEPS00558
PRINTSPR00185
PIRA44422
Signal peptide annotation
No information available
TM annotation
# beta strands19
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOMMMMMMMMIIIIIIIIIMMMMM
MMMOOOOOMMMMMMMMIIIIMMMMMMMMOOOOOOMMMMMMMIIIIIIIIIIIMMMMMMMO
OMMMMMMMMIIIIIIIIIMMMMMMMMOOMMMMMMMIIIIIIIIIIIIMMMMMMMOOOMMM
MMMMIIIIIIMMMMMMOOOOOOMMMMMMMIIIIIIIIIMMMMMMMOOOOOOMMMMMMMII
IIMMMMMMMOOOOOMMMMMMMMMIIIIIIIIIIIMMMMMMMMO
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen