Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151233::      
Protein information
OMPdb FamilyThe Omptin (OmpT) Family
Protein descriptionFerric-anguibactin receptor FatA
Gene nameName=fatA
SpeciesYersinia pestis
NCBI taxonomy632
Protein sequence

MKKSSIVATIITILSGSANAASSQLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKI
SQLDWKIKNVAILKGDISWDPYSFLTLNARGWTSLASGSGNMDDYDWMNENQSEWTDHSS
HPATNVNHANEYDLNVKGWLLQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFP
KGVRVIGYNQRFSMPYIGLAGQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTS
GSRYYGTVINAGYYVTPNAKVFAEFTYSKYDEGKGGTQTIDKNSGDSVSIGGDAAGISNK
NYTVTAGLQYRF
Sequence length312 AA
FragmentNo
pHHM coverage99.65 %
Cross-references
UniprotP17811
PDB2X4M | 2X55 | 2X56 | 4DCB
PfamPF01278
EMBLX15136 | M27820 | AF053945 | AL109969 | AE017046
InterProIPR020080 | IPR020079 | IPR000036
PROSITEPS00834 | PS00835
PRINTSPR00482
PIRA42928 | S06979
Signal peptide annotation
Amino acids1-20
Sequence

MKKSSIVATIITILSGSANA
Annotation sourceExperimentally verified
TM annotation
# beta strands10
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOO
OOOOOOMMMMMMMMMMMMMIIIIIMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOMMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMMMMMMIIIIIIMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOM
MMMMMMMMMMMMMIIIIIIMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMMMMMII
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen