Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151231::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerric-anguibactin receptor FatA
Gene nameName=fatA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MFRLNPFVRVGLCLSAISCAWPVLAVDDDGETMVVTASSVEQNLKDAPASISVITQEDLQ
RKPVQNLKDVLKEVPGVQLTNEGDNRKGVSIRGLDSSYTLILVDGKRVNSRNAVFRHNDF
DLNWIPVDSIERIEVVRGPMSSLYGSDALGGVVNIITKKIGQKWSGTVTVDTTIQEHRDR
GDTYNGQFFTSGPLIDGVLGMKAYGSLAKREKDDPQNSTTTDTGETPRIEGFSSRDGNVE
FAWTPNQNHDFTAGYGFDRQDRDSDSLDKNRLERQNYSVSHNGRWDYGTSELKYYGEKVE
NKNPGNSSPITSESNTVDGKYTLPLTAINQFLTVGGEWRHDKLSDAVNLTGGTSSKTSAS
QYALFVEDEWRIFEPLALTTGVRMDDHETYGEHWSPRAYLVYNATDTVTVKGGWATAFKA
PSLLQLSPDWTSNSCRGACKIVGSPDLKPETSESWELGLYYMGEEGWLEGVESSVTVFRN
DVKDRISISRTSDVNAAPGYQNFVGFETGANGRRIPVFSYYNVNKARIQGVETELKIPFN
DEWKLSINYTYNDGRDVSNGENKPLSDLPFHTANGTLDWKPLALEDWSFYVSGHYTGQKR
ADSATAKTPGGYTIWNTGAAWQVTKDVKLRAGVLNLGDKDLSRDDYSYNEDGRRYFMAVD
YRF
Sequence length663 AA
FragmentNo
pHHM coverage93.93 %
Cross-references
UniprotP17315
PDB2HDF | 2HDI
PfamPF07715 | PF00593
EMBLJ04229 | U00007 | U00096 | AP009048 | M19295 | M89774
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR010916 | IPR036942 | IPR010917
PROSITEPS00430 | PS01156
PIRB64984
Signal peptide annotation
Amino acids1-25
Sequence

MFRLNPFVRVGLCLSAISCAWPVLA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMM
MMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMIIMMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOO
OOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMIIIIMMMMMMMMOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMM
MMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen