Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151229::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerric-anguibactin receptor FatA
Gene nameName=fatA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MLSTQFNRDNQYQAITKPSLLAGCIALALLPSAAFAAPATEETVIVEGSATAPDDGENDY
SVTSTSAGTKMQMTQRDIPQSVTIVSQQRMEDQQLQTLGEVMENTLGISKSQADSDRALY
YSRGFQIDNYMVDGIPTYFESRWNLGDALSDMALFERVEVVRGATGLMTGTGNPSAAINM
VRKHATSREFKGDVSAEYGSWNKERYVADLQSPLTEDGKIRARIVGGYQNNDSWLDRYNS
EKTFFSGIVDADLGDLTTLSAGYEYQRIDVNSPTWGGLPRWNTDGSSNSYDRARSTAPDW
AYNDKEINKVFMTLKQQFADTWQATLNATHSEVEFDSKMMYVDAYVNKADGMLVGPYSNY
GPGFDYVGGTGWNSGKRKVDALDLFADGSYELFGRQHNLMFGGSYSKQNNRYFSSWANIF
PDEIGSFYNFNGNFPQTDWSPQSLAQDDTTHMKSLYAATRVTLADPLHLILGARYTNWRV
DTLTYSMEKNHTTPYAGLVFDINDNWSTYASYTSIFQPQNDRDSSGKYLAPITGNNYELG
LKSDWMNSRLTTTLAIFRIEQDNVAQSTGTPIPGSNGETAYKAVDGTVSKGVEFELNGAI
TDNWQLTFGATRYIAEDNEGNAVNPNLPRTTVKMFTSYRLPVMPELTVGGGVNWQNRVYT
DTVTPYGTFRAEQGSYALVDLFTRYQVTKNFSLQGNVNNLFDKTYDTNVEGSIVYGTPRN
FSITGTYQF
Sequence length729 AA
FragmentNo
pHHM coverage98.24 %
Cross-references
UniprotP16869
PDB6E4V
PfamPF07715 | PF00593
EMBLX17615 | U00096 | AP009048
InterProIPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR010916 | IPR036942 | IPR010917 | IPR010105
PROSITEPS00430 | PS01156
PIRC64854
Signal peptide annotation
Amino acids1-36
Sequence

MLSTQFNRDNQYQAITKPSLLAGCIALALLPSAAFA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOO
OOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMMMMMMM
MMMMIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOO
OOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMM
MMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMII
IIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen