Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151211::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerric-anguibactin receptor FatA
Gene nameName=fatA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MTPLRVFRKTTPLVNTIRLSLLPLAGLSFSAFAAQVNIAPGSLDKALNQYAAHSGFTLSV
DASLTRGKQSNGLHGDYDVESGLQQLLDGSGLQVKPLGNNSWTLEPAPAPKEDALTVVGD
WLGDARENDVFEHAGARDVIRREDFAKTGATTMREVLNRIPGVSAPENNGTGSHDLAMNF
GIRGLNPRLASRSTVLMDGIPVPFAPYGQPQLSLAPVSLGNMDAIDVVRGGGAVRYGPQS
VGGVVNFVTRAIPQDFGIEAGVEGQLSPTSSQNNPKETHNLMVGGTADNGFGTALLYSGT
RGSDWREHSATRIDDLMLKSKYAPDEVHTFNSLLQYYDGEADMPGGLSRADYDADRWQST
RPYDRFWGRRKLASLGYQFQPDSQHKFNIQGFYTQTLRSGYLEQGKRITLSPRNYWVRGI
EPRYSQIFMIGPSAHEVGVGYRYLNESTHEMRYYTATSSGQLPSGSSPYDRDTRSGTEAH
AWYLDDKIDIGNWTITPGMRFEHIESYQNNAITGTHEEVSYNAPLPALNVLYHLTDSWNL
YANTEGSFGTVQYSQIGKAVQSGNVEPEKARTWELGTRYDDGALTAEMGLFLINFNNQYD
SNQTNDTVTARGKTRHTGLETQARYDLGTLTPTLDNVSIYASYAYVNAEIREKGDTYGNL
VPFSPKHKGTLGVDYKPGNWTFNLNSDFQSSQFADNANTVKESADGSTGRIPGFMLWGAR
VAYDFGPQMADLNLAFGVKNIFDQDYFIRSYDDNNKGIYAGQPRTLYMQGSLKF
Sequence length774 AA
FragmentNo
pHHM coverage95.11 %
Cross-references
UniprotP13036
PDB1KMO | 1KMP | 1PNZ | 1PO0 | 1PO3 | 1ZZV | 2D1U
PfamPF07715 | PF07660 | PF00593
EMBLM20981 | U14003 | U00096 | AP009048 | M63115 | M26397
InterProIPR012910 | IPR037066 | IPR011662 | IPR000531 | IPR010916 | IPR036942 | IPR010917 | IPR010105
SMARTSM00965
PROSITEPS00430 | PS01156
PIRE65242
Signal peptide annotation
Amino acids1-33
Sequence

MTPLRVFRKTTPLVNTIRLSLLPLAGLSFSAFA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMM
OOOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMMIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMMMOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOOOOMMMMMMMIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMM
MMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen