Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151200::      
Protein information
OMPdb FamilyThe FadL Outer Membrane Protein (FadL) Family
Protein descriptionOuter membrane protein MtrB
Gene nameName=MDM10, OrderedLocusNames=CNBN0730
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MSQKTLFTKSALAVAVALISTQAWSAGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPA
LITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWG
ASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKI
ERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILY
ELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMW
EVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYY
DDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSV
KINEGPYQFESEGKAWLFGTNFNYAF
Sequence length446 AA
FragmentNo
pHHM coverage99.77 %
Cross-references
UniprotP10384
PDB1T16 | 1T1L | 2R4L | 2R4N | 2R4O | 2R4P | 2R88 | 2R89 | 2R8A | 3DWN | 3PF1 | 3PGR | 3PGS | 3PGU
PfamPF03349
EMBLM60607 | U00096 | AP009048 | Y00552
InterProIPR005017 | IPR042117
PIRF65007
Signal peptide annotation
Amino acids1-25
Sequence

MSQKTLFTKSALAVAVALISTQAWS
Annotation sourceExperimentally verified
TM annotation
# beta strands14
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMM
MMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMM
IIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMII
IIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMIIIMMMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen