Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151168::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Nucleoside-specific Channel-forming Outer Membrane Porin (Tsx) Family
Protein descriptionNucleoside-specific channel-forming protein Tsx
Gene nameName=tsx, Synonyms=nupA, Name=tsx, Synonyms=nupA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLE
YEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGP
FKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANEN
EWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSH
ILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF
Sequence length294 AA
FragmentNo
pHHM coverage99.59 %
Cross-references
UniprotP0A927
PDB1TLW | 1TLY | 1TLZ
PfamPF03502
EMBLM57685 | U82664 | U00096 | AP009048
InterProIPR003055 | IPR018013 | IPR036777
PRINTSPR01277
PIRJQ0798
Signal peptide annotation
Amino acids1-22
Sequence

MKKTLLAAGAVLALSSSFTVNA
Annotation sourceExperimentally verified
TM annotation
# beta strands12
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMMOOOOMMMMMMM
MMMMMIIIIMMMMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMMMMMIIIIIIIIIIII
IIIMMMMMMMMMMMMOOOOOMMMMMMMMMMMMMIIIIIIMMMMMMMMMMMMMMOOOOOOM
MMMMMMMMMMMMMIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMM
MMMMMIIMMMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen