Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151161::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Protein X (OmpX) Family
Protein descriptionOuter membrane protein A
Gene nameName=ompA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MKKIACLSALAAVLAFTAGTSVAATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPL
GVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPT
YKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Sequence length171 AA
FragmentNo
pHHM coverage99.44 %
Cross-references
UniprotP0A917
PDB1ORM | 1Q9F | 1Q9G | 1QJ8 | 1QJ9 | 2M06 | 2M07 | 2MNH
PfamPF13505
EMBLL37088 | U00096 | AP009048 | U04242
InterProIPR000758 | IPR011250 | IPR027385
PROSITEPS00694 | PS00695
PRINTSPR00316
PIRI55173
Signal peptide annotation
Amino acids1-23
Sequence

MKKIACLSALAAVLAFTAGTSVA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMOOOOOOOOMMMMMMMMMIIIIIIII
IMMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMIIIIIIIMMMMMMMMMMOOOOOOOOOO
OOOOOOOMMMMMMMMMMMIIIIIIMMMMMMMMMMOOOOMMMMMMMMMMIII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen