Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151138::      
Protein information
OMPdb FamilyThe Omptin (OmpT) Family
Protein descriptionOuter membrane protein A
Gene nameName=ompA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVS
QLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESR
HPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDI
GSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVESSDNDEHYDPGKRIT
YRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKGNTSLYDHNNNTSDYSKNGA
GIENYNFITTAGLKYTF
Sequence length317 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP09169
PDB1I78
PfamPF01278
EMBLX06903 | M23630 | U82598 | U00096 | AP009048
InterProIPR020080 | IPR020079 | IPR000036
PROSITEPS00834 | PS00835
PRINTSPR00482
PIRA31387
Signal peptide annotation
Amino acids1-20
Sequence

MRAKLLGIVLTTPIAISSFA
Annotation sourceExperimentally verified
TM annotation
# beta strands10
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOOOOOOOOO
OOOOOMMMMMMMMMMMMMIIIIIMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOMMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMMMMMMIIIIIIMMMMMMMMMMMMMMOOOOOOOOOOOOOO
OOOOOMMMMMMMMMMMMMMIIIIIIMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOO
OOOMMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen