Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151129::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Fimbrial Usher Porin (FUP) Family
Protein descriptionFerrichrome outer membrane transporter/phage receptor
Gene nameSynonyms=tonA
SpeciesEscherichia coli
NCBI taxonomy562
Protein sequence

MKDRIPFAVNNITCVILLSLFCNAASAVEFNTDVLDAADKKNIDFTRFSEAGYVLPGQYL
LDVIVNGQSISPASLQISFVEPALSGDKAEKKLPQACLTSDMVRLMGLTAESLDKVVYWH
DGQCADFHGLPGVDIRPDTGAGVLRINMPQAWLEYSDATWLPPSRWDDGIPGLMLDYNLN
GTVSRNYQGGDSHQFSYNGTVGGNLGPWRLRADYQGSQEQSRYNGEKTTNRNFTWSRFYL
FRAIPRWRANLTLGENNINSDIFRSWSYTGASLESDDRMLPPRLRGYAPQITGIAETNAR
VVVSQQGRVLYDSMVPAGPFSIQDLDSSVRGRLDVEVIEQNGRKKTFQVDTASVPYLTRP
GQVRYKLVSGRSRGYGHETEGPVFATGEASWGLSNQWSLYGGAVLAGDYNALAAGAGWDL
GVPGTLSADITQSVARIEGERTFQGKSWRLSYSKRFDNADADITFAGYRFSERNYMTMEQ
YLNARYRNDYSSREKEMYTVTLNKNVADWNTSFNLQYSRQTYWDIRKTDYYTVSVNRYFN
VFGLQGVAVGLSASRSKYLGRDNDSAYLRISVPLGTGTASYSGSMSNDRYVNMAGYTDTF
NDGLDSYSLNAGLNSGGGLTSQRQINAYYSHRSPLANLSANIASLQKGYTSFGVSASGGA
TITGKGAALHAGGMSGGTRLLVDTDGVGGVPVDGGQVVTNRWGTGVVTDISSYYRNTTSV
DLKRLPDDVEATRSVVESALTEGAIGYRKFSVLKGKRLFAILRLADGSQPPFGASVTSEK
GRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQK
Sequence length836 AA
FragmentNo
pHHM coverage99.82 %
Cross-references
UniprotP07110
PDB2KT6 | 2VQI | 3FIP | 6CD2
PfamPF13953 | PF13954 | PF00577
EMBLY00529 | X61239 | AF481883
InterProIPR000015 | IPR018030 | IPR042186 | IPR025949 | IPR043142 | IPR025885 | IPR037224
PROSITEPS01151
PIRS25218
Signal peptide annotation
Amino acids1-24
Sequence

MKDRIPFAVNNITCVILLSLFCNA
Annotation sourceExperimentally verified
TM annotation
# beta strands24
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMM
MMOOOOOOOOOOOOMMMMMMMIIIIIIIIIMMMMMMOOOOOOOOOOOOOOOOOMMMMMMM
IIIIIIIIIIIMMMMMMOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIMMMMMMMOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOMMMMMMMII
IIIIMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMIIIIIIIIMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMIIIIIIIMMMMMMOOOOOOOOOOOOOOMMMMMMIII
IIIIIIIMMMMMMOOOOOOOOOOOOOMMMMMMIIIIIMMMMMMOOOOOOOOOMMMMMIII
IIIIIIMMMMMOOOOOOOOOOOOOMMMMMMIIIIIIIMMMMMMOOOOOOOOMMMMMMIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen