Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151128::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionFerrichrome outer membrane transporter/phage receptor
Gene nameSynonyms=tonA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MKVKVLSLLVPALLVAGAANAAEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLG
FKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYD
VTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGE
GFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAE
TYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQ
SKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVA
LGLVYQF
Sequence length367 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP06996
PDB2J1N | 2J4U | 2ZLE | 4A8D
PfamPF00267
EMBLK00541 | U00096 | AP009048 | U00008
InterProIPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
PIRA20867
Signal peptide annotation
Amino acids1-21
Sequence

MKVKVLSLLVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMM
MMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen