Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151127::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionFerrichrome outer membrane transporter/phage receptor
Gene nameName=fhuA, Synonyms=tonA, Synonyms=tonA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVTAAPAPQESAWGPAAT
IAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALSYTPGVSVGTRGASNTY
DHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAEIMRGPVSVLYGKSSPGG
LLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGVYSYRLTGLARSANAQQKG
SEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLPKEGTVEPLPNGKRLPTDFN
EGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSK
QCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFATGDIDHTLLTGVDFMRMRNDI
NAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRILNKQKQTGVYVQDQAQWDKVLV
TLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNYLFDNGVTPYFSYSESFEPSSQVG
KDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNLTKTNNLMADPEGSFFSVEGGEIRA
RGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYKGNTPAQVPKHMASLWADYTFFDGPL
SGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDALVRYDLARVGMAGSNVALHVNNLFDRE
YVASCFNTYGCFWGAERQVVATATFRF
Sequence length747 AA
FragmentNo
pHHM coverage95.69 %
Cross-references
UniprotP06971
PDB1BY3 | 1BY5 | 1FCP | 1FI1 | 1QFF | 1QFG | 1QJQ | 1QKC | 2FCP | 2GRX | 4CU4
PfamPF07715 | PF00593
EMBLM12486 | U00096 | AP009048 | U70214 | X05810
InterProIPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR010916 | IPR036942 | IPR010917 | IPR010105
PROSITEPS00430 | PS01156
PIRF64738
Signal peptide annotation
Amino acids1-33
Sequence

MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOO
OOOOOOOOOOMMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIMMM
MMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMIIIIIMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen