Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151119::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionOuter membrane protein A
Gene nameName=ompA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNLQAPGVSTITADEIRK
NPVARDVSKIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENTLILIDGKPVSSRNSVR
QGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGVVNIITKKGSGEWHGSWD
AYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDKTQADAWDINQGHQSARAGTYA
TTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNLYAGDTQNTNSDSYTRSKYG
DETNRLYRQNYALTWNGGWDNGVTTSNWVQYEHTRNSRIPEGLAGGTEGKFNEKATQDFV
DIDLDDVMLHSEVNLPIDFLVNQTLTLGTEWNQQRMKDLSSNTQALTGTNTGGAIDGVST
TDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHSIVGNNWSPALNISQGLGDDFTL
KMGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCYLQGNDDLKAETSINKEIGLEFKR
DGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTDLYQWDNVPKAVVEGLEGSLNVPVSETV
MWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSWQAREDLSMQTTFTWYGKQQPKKYNY
KGQPAVGPETKEISPYSIVGLSATWDVTKNVSLTGGVDNLFDKRLWRAGNAQTTGDLAGA
NYIAGAGAYTYNEPGRTWYMSVNTHF
Sequence length746 AA
FragmentNo
pHHM coverage97.65 %
Cross-references
UniprotP05825
PDB1FEP
PfamPF07715 | PF00593
EMBLM13748 | U82598 | U00096 | AP009048 | J04216
InterProIPR039426 | IPR012910 | IPR037066 | IPR000531 | IPR010916 | IPR036942 | IPR010917 | IPR010105
PROSITEPS00430 | PS01156
PIRF64791
Signal peptide annotation
Amino acids1-22
Sequence

MNKKIHSLALLVNLGIYGVAQA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOO
OOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMMMMMMMMMMM
IIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOMMMMMMMIIIIIIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMMIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOMMMMMMMMIIIIIMMM
MMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIM
MMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen