Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151118::      
Protein information
OMPdb FamilyThe Pseudomonas OprP Porin (POP) Family
Protein descriptionOuter membrane protein A
Gene nameName=ompA
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MIRRHSCKGVGSSVAWSLLGLAISAQSLAGTVTTDGADIVIKTKGGLEVATTDKEFSFKL
GGRLQADYGRFDGYYTNNGNTADAAYFRRAYLEFGGTAYRDWKYQINYDLSRNVGNDSAG
YFDEASVTYTGFNPVNLKFGRFYTDFGLEKATSSKWVTALERNLTYDIADWVNDNVGTGI
QASSVVGGMAFLSGSVFSENNNDTDGDSVKRYNLRGVFAPLHEPGNVVHLGLQYAYRDLE
DSAVDTRIRPRMGMRGVSTNGGNDAGSNGNRGLFGGSSAVEGLWKDDSVWGLEGAWALGA
FSAQAEYLRRTVKAERDREDLKASGYYAQLAYTLTGEPRLYKLDGAKFDTIKPENKEIGA
WELFYRYDSIKVEDDNIVVDSATREVGDAKGKTHTLGVNWYANEAVKVSANYVKAKTDKI
SNANGDDSGDGLVMRLQYVF
Sequence length440 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP05695
PDB2O4V
PfamPF07396
EMBLX53313 | M86648 | AE004091 | Y00553
InterProIPR023614 | IPR010870
PIRF83235 | S11793
Signal peptide annotation
Amino acids1-29
Sequence

MIRRHSCKGVGSSVAWSLLGLAISAQSLA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
MMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIIIIIMMMMMMMMMMMMOOOOM
MMMMMMMMIIIIIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMM
MMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIII
MMMMMMMOOOOOOOOOOOOOOOOOOOMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIIII
MMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMIIIIIMMMMMMMOOOOOOOO
OOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen