Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151105::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionPorA class 1 protein
Gene nameName=porA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFG
FKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALY
DVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRD
VKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDAN
NIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDE
DLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF
Sequence length351 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP02932
PDB1PHO
PfamPF00267
EMBLV00316 | U70214 | U00096 | AP009048 | X00786
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
PIRA03432
Signal peptide annotation
Amino acids1-21
Sequence

MKKSTLALVVMGIVASASVQA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOO
OOOOOOOOOMMMMMMMIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMII
IMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOO
OOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen