Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1151104::      
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionPorA class 1 protein
Gene nameName=porA
SpeciesEscherichia coli (strain K12)
NCBI taxonomy83333
Protein sequence

MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDM
TYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDY
GRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYL
GKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKS
KAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVY
QF
Sequence length362 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotP02931
PDB1BT9 | 1GFM | 1GFN | 1GFO | 1GFP | 1GFQ | 1HXT | 1HXU | 1HXX | 1MPF | 1OPF | 2OMF | 2ZFG | 2ZLD | 3FYX | 3HW9 | 3HWB | 3K19 | 3K1B | 3O0E | 3POQ | 3POU | 3POX | 4D5U | 4GCP | 4GCQ | 4GCS | 4JFB | 4LSE | 4LSF | 4LSH | 4LSI | 5NUO | 5NUQ | 5NUR
PfamPF00267
EMBLJ01655 | U00096 | AP009048
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
PIRA93449
Signal peptide annotation
Amino acids1-22
Sequence

MMKRNILAVIVPALLVAGTANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOMMMMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMMMIIMMMMMM
MMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOO
OOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMMM
MMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOO
OOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMM
MI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen