Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1103932::      
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionPutative copper transport outer membrane porin OprC
Gene nameName=oprC, OrderedLocusNames=PA3790
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MEKRMSTQQRAAGNACPTAAFSFDPARLAQRRRWAGAFAALCGLALSPSALLAEEHSQHQ
DHAVELAPSVVTGVAQSSPLTIVTNPKEPRQPVPASDGADYLKTIPGFAVIRNGGSNGDP
VLRGMFGSRLNILTNGGMMLGACPNRMDAPTSYISPETYDKLTVIKGPQTVLWGPGASAG
TILFEREPERFGELGSRVNASLLAGSNGRFDKVLDAAAGNRLGYLRFTGNHAQSDDYEDG
AGNTVPSRWKKWNGDVAVGWTPDEDTLIELTAGKGDGEARYAGRGMDGSQFKRESLGLRF
VKSNVSDVLEKVEAQVYYNYADHIMDNFRLRTPDPSSMMPMPMASQVDRRTLGGRLAATW
RWDDFKLVTGVDAMRNEHRARGSKYDMMTDYYTDADQFPWSKDAVFHNYGAFGELTWFAA
ERDRLIGGLRLDRASVKDYRQTLKSGHMGHAMANPTANDTRADTLPSGFVRYEHDLADSP
TTLYAGLGHAERFPDYWELFSPKRGPNGSVNAFDKIKPEKTTQLDFGLQYNGDKLQAWAS
GYVGVVQDFILFSYREGMMGSSTQATNVDARIMGGELGASYQLTGNWKTDASLAYAWGKN
SSDDRALPQIPPLEARFGLTYEEGDWSAGSLWRVVAPQNRIARDQGNVVGKDFDKSAGFG
VFSLNGAYRVTRNVKLSAGVDNLFDKDYTEHLNKAGDAGFGFSANETVPEPGRTFWTKVD
FSF
Sequence length723 AA
FragmentNo
pHHM coverage92.76 %
Cross-references
UniprotG3XD89
PDB6FOK | 6FOM
PfamPF07715 | PF00593
EMBLAE004091
InterProIPR039426 | IPR012910 | IPR037066 | IPR010100 | IPR000531 | IPR036942
PIRF83173
Signal peptide annotation
Amino acids1-52
Sequence

MEKRMSTQQRAAGNACPTAAFSFDPARLAQRRRWAGAFAALCGLALSPSALL
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMM
OOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMIMMMMMM
MMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMM
MIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIII
IIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIII
IIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMII
IMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIMMMMMM
MMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOO
OMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMM
MMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen