Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1103930::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionProbable outer membrane receptor for iron transport
Gene nameOrderedLocusNames=PA4514
SpeciesPseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM14847 / LMG 12228 / 1C / PRS 101 / PAO1)
NCBI taxonomy208964
Protein sequence

MSRQSTDTAVSSQRLLASAIGVAITAIAAPQAAQADEAGQKKTDKDRVLSLDAATIVGEQ
QDETTYNVDRSASKKYTAPLLDTPKTVTVIPQQVIKDTGALTLADALRTTPGITFGAGEG
GNPAGDRPFIRGFNAESDTFLDGMRDVASQTREVFNVEQIEVSKGPGSAYTGAGSTGGSL
NLISKTAKQDNFTDAGFTWGSDQTRRTTLDVNRMIGDNAAFRLNLMKHDAHVAGRDEVSV
SRWGVAPTVTFGFDTPTRATLSYYHLSTDDMPDYGLPLTNVNRSKANPSKPASVDRDNFY
GLKDRDYRKSTTDSGTFRIEHDLNDNLTLSNSTRLVRTTLDYIVSNPDDSRGNVANGYVY
RSAKSRNSTSKGWVNQTDLKANFETGFIKHTLVTGLEFSYEDVHNRPYAITSGGGAGNTC
NARLLASGDCTSLNRPTPGDNWTGSITDGLAYTDTDTKTSAAYVFDTLKLSEQWELNLGL
RYDDFDTKSSGYQTAGRNGPAGYFKRENNSHFWNYQTGLVYKPAPNGSIYLAWSTSSNPT
GETGGEGQADISVGNNGLDPERNRNLELGTKWAFFDDALSLNAALFRTDKTNARVASPDV
STLQVLDGEQRVQGVELGFNGKLTEKWKVFGGYTYLDSEIRKSTVKSDEGNKMPQTAQNN
FTLWTTYDLLQNFTIGGGTTYVDKQYGNTANSTYIPSYWRYDAMASYKVSKNVDLQLNVQ
NLTDKRYFDQVYSTHMAHVAPGRTALLGVNFHF
Sequence length753 AA
FragmentNo
pHHM coverage95.30 %
Cross-references
UniprotG3XCY8
PDB5FOK
PfamPF07715 | PF00593
EMBLAE004091
InterProIPR030148 | IPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR036942 | IPR010105
PIRD83081
Signal peptide annotation
Amino acids1-35
Sequence

MSRQSTDTAVSSQRLLASAIGVAITAIAAPQAAQA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOO
OOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOMMMMMMMIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMM
MMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen