Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1094836::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOmpC protein
Gene nameName=ompK36, Synonyms=ompC, ORFNames=BN49_3852, F3G25_01870, FCH06_012025, NCTC13635_01536, SAMEA104567853_00166, SAMEA1712987_03648, SAMEA3729660_02988, SAMEA4364603_01311, SAMEA4873632_02128
SpeciesKlebsiella pneumoniae
NCBI taxonomy573
Protein sequence

MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVG
VKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVY
DVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSG
EGATNNGRGWSKQNGDGFGTSLTYDIWDGISAGFAYSHSKRTDEQNSVPALGRGDNAETY
TGGLKYDANNIYLASQYTQTYNATRAGSLGFANKAQNFEVVAQYQFDFGLRPSVAYLQSK
GKDLERGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTRNAGISTDDVVALG
LVYQF
Sequence length365 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotF2VN85
PDB5NUP
PfamPF00267
EMBLGU461279 | FO834906 | VWRA01000002 | UFEU01000003 | UJRJ01000008 | SUOY02000010 | UNZU01000012 | LR134162 | CAAGXW010000001 | CAAHCC010000003
InterProIPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-21
Sequence

MKVKVLSLLVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOO
OOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMM
MMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen