Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1088899::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOmpK36
Gene nameName=ompK36, Synonyms=ompC, ompC_1, ORFNames=CK508_004435, DM060_20240, DM078_03995, SAMEA3649709_00969, SAMEA3673128_00750
SpeciesKlebsiella pneumoniae
NCBI taxonomy573
Protein sequence

MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVG
VKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVY
DVTSWTDVLPEFGGDGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSV
SGEGALSPTNNGRTALKQNGDGYGTSLTYDIYDGISAGFAYSNSKRLGDQNSKLALGRGD
NAETYTGGLKYDANNIYLATQYTQTYNATRAGSLGFANKAQNFEVVAQYQFDFGLRPSVA
YLQSKGKDLEGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTHNAGISTDDV
VALGLVYQF
Sequence length369 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotE5G6G2
PDB6RCP
PfamPF00267
EMBLHM769261 | KC195779 | QOHW01000002 | QOUF01000592 | NTHY02000014 | UIYB01000002 | UJGS01000003
InterProIPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-21
Sequence

MKVKVLSLLVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMM
MMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOO
OOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMM
MMOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOO
MMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen