Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1087565::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionPorin 1
Gene nameName=ompC, ORFNames=NCTC11800_01286
SpeciesProvidencia stuartii
NCBI taxonomy588
Protein sequence

MMKRNILAMVIPALLAAGAANAAEVYNKDGNKLDVYGKVDVRHYFASADKGKKSEDGDDS
RVRLGVKGDTQITDQLTGFGRFEWETKTNKAENEGENKNRLAYAGLKFADFGSIDYGRNY
GVVYDTNAWTDVFPLWGADTMAQTDNFMTSRNRNLLTYRNNNAFGYVDGLSFALQYQGKN
GDNNKSSAGMAKDNGDGYGFSTAYELGWGVTLGGGYSSSSRTPNQKAGVVTSEGDSYYSA
TGKRAQAWNVGGKFDANNVYLAAMYGQTQNTSRYGDLDLIANKTENVELVAQYLFDFGLK
PSIGYNQSKGKNLGNGYDNQDLVKYISVGSYYYFNKNMSAVVDYKINLLKDNDFTKEYGI
NTDNVLGLGLVYQF
Sequence length374 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotE3U904
PDB4D64 | 5N9I | 5NXN | 5NXR | 5NXU
PfamPF00267
EMBLHM070418 | UGUC01000002
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-22
Sequence

MMKRNILAMVIPALLAAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMIIMMMMMMMMMM
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOO
OOOOOOOOOOOOOOOOOOMMMMMMMIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMM
MMMMMMOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOO
OOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen