Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1074278::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionTonB-dependent siderophore receptor
Gene nameORFNames=HMPREF0010_01753
SpeciesAcinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
NCBI taxonomy575584
Protein sequence

MSLIRTRKKIVSSAIASSLSMIATTAMAQEAVSQLPTIHTKATQEESLKVDQSANSKFVA
PLLDTPKSVSVISKQLIEDTKVTTLADALRTVPGITLGAGEGGNPNGDRPFIRGYSSESS
MYIDGIRNSTSQNREMFAVEQVEVTKGSASAMGGAGSVGGSINMISKVAKKGDFLEGSVA
AGTDNYQRITLDGNKDFGNGIAARVAVLGHQNEKAGQSNGAEYKRVGIAPSITFGLDTPT
RATLSYYYLQTDDKPDSGIPYWDSSLGKAQGKPAEVKQGTYYGWKDRDFQKQENHIGTIK
LEHDLTDNITITNTAMYAKSKNDYVWTNPDDSKGNVGKGLVWHRLNSAITDSETFTDQLA
LTGKFDTGFLKHRFNVGAEYSKQKTDKGGYNIIDAKGNVSSTGFYSDCSDLSTNWCTSLN
GPTQKPFVDRLQARPDFDATVESTSVYLLDNIEITPKWLLDLGLRWDKFEAEQNFLATSS
AAAYTAKNNSDFVTYQAGITFKPTENGSIYTSYATSASPVGLNAGWGDNSETINANNQMI
DPEEAQTFEIGTKWDFLDNHLNLTAAIFRTEKQNTRVQIDPTTYANVGESKVDGFELGLN
GEITDKWNISAGYTYLDSELTKNGKSCRSGKCTDQSIYNGNQMPNVPKQAATLWTTYKVL
PQLTVGAGAVYSDKVYGDVANTKWVPSYVRYDAMARYNVNKNVDLQLNINNLSDKRYFTK
AYASHYATEAEGRSAVLAVNFKY
Sequence length743 AA
FragmentNo
pHHM coverage98.04 %
Cross-references
UniprotD0CAH3
PDB5FP1
PfamPF07715 | PF00593
EMBLGG704574
InterProIPR030148 | IPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR036942 | IPR010105
Signal peptide annotation
Amino acids1-27
Sequence

MSLIRTRKKIVSSAIASSLSMIATTAM
Annotation sourcePredicted [SignalP 5.0]
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOMMM
MMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOOMMMMMMMMMMMMMMMMMMMMMMMIII
IIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMIIII
IIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMM
MIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen