Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1070807::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Outer Membrane Receptor (OMR-TonB Dependent Receptor) Family
Protein descriptionEnantio-pyochelin receptor
Gene nameName=fetA
SpeciesPseudomonas fluorescens
NCBI taxonomy294
Protein sequence

MGSRVAHRNTSGCPVNCVVSRPALGRNPLACLIHGLALGLSLTQAGAALAADGDTDQDHA
LTLDTSVISATQPDSATGPQAGYVAKRSLSGTKTDASLSEIPQSISVITRDQMDAQQVQS
VNEALRYTAGVQANTTAASQRFDTLSIRGFDVTTGMLRDGLKGNTAQAWPKVEAYGLERI
DVLKGPASVLFGQNSPGGVVNQISKRPLDKPFHEVQIQGGSFDRAQGQFDFSGPLDDEGQ
FLYRLVGLERDSGTQFDHIKDDKQYFAPSFTWKPNDDTSLTLLADYTQDTFGAPRVFLPA
QGTLLGNPNGKVRHNVFLDEPGLDNDRTQYSLGYLLEHRLNDVWSLNSSARYGHVNLLTN
TASGMSLAPDLRTLNRAAYRFRIVGDTYSLDNNAQARWNLGSTQMVSLLGIDYRRTREDY
YLRGGSASPIDIYNPVHGGVFDPSTPFTNTVQRADQVGVYAQQQFTFDEHWVLTVGGRQD
RSSARTDNRMNDSGSKQDDEKFTYRTGLVYLADNGLAPYISYSTSFDPVLGTNFYGTPYK
PTSAKQSEVGVKYQPPGIDSYITLSLFDLTQENVLTTDPAQRLNKIQTGEINVRGIELEG
KASLARGLDLLAALTYNDAEVSKSNNPLEKGKRPTDTPEKMASLWADYTLPEGPLSGLGF
GAGVRYIGSTEADAANTQRVPSYTLLDAAVHYDFDKLIPAAKGLRLAVNATNLTDKHYYE
GCSLTNCSAGYDRSVIASLRYRW
Sequence length743 AA
FragmentNo
pHHM coverage99.22 %
Cross-references
UniprotC5I2D9
PDB3QLB
PfamPF07715 | PF00593
EMBLFJ641192 | JQ627635
InterProIPR012910 | IPR037066 | IPR039423 | IPR000531 | IPR036942 | IPR010105
Signal peptide annotation
Amino acids1-50
Sequence

MGSRVAHRNTSGCPVNCVVSRPALGRNPLACLIHGLALGLSLTQAGAALA
Annotation sourceExperimentally verified
TM annotation
# beta strands22
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIMMMMMMMMOOOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOO
OOOOOMMMMMMMMMMMMMMMMMMMMMMMMMMIIIIIIIIMMMMMMMMOOOOOOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMMO
OOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOO
OOOOOOMMMMMMMIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIMMM
MMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIMMMMMMMMOOOOOOOOO
OOOOOOOOOOOOOOMMMMMMMMM
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen