Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1070359::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe Imp/OstA Family
Protein descriptionLPS-assembly protein LptD
Gene nameName=imp, Name=imp, Name=imp, ORFNames=B4U21_00320, B6R99_09395, BANRA_01971, BANRA_03252, BL124_00028160, BN49_4289, C2U49_23700, C3F39_10720, CK508_015605, D4N17_00690, DD583_03520, DM078_10935, EAO17_18030, EXT45_14840, F0330_05110, F3G17_18020, F3G25_12930, FAT93_02725, FBF54_22000, FCH06_005500, FKC87_04370, FXN60_14545, G4V17_09795, G7B13_15255, GJD55_09085, GNF04_06015, GR697_21560, NCTC11679_04806, NCTC13443_01619, NCTC13465_04526, NCTC8849_00994, NCTC9637_05670, SAMEA104567806_01314, SA
SpeciesKlebsiella pneumoniae
NCBI taxonomy573
Protein sequence

MKKRIPSLLATMIASALYSQQGLAADLATQCMLGVPSYDRPLVEGRPGDLPVTINADHAK
GNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTVDALGNVHYDDNQVILK
GPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYTILENGSFTSCLPGSDTW
SVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGDKRRSGFLIPNAKYSTKNG
VEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQLGSGLTEFDYLPSDKVYED
DHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYFNDFSSKYGSSTDGYATQKFS
AGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYYQNDVGPFDTHLYGQVAHFVNS
NNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHYQQSNLDKYNAANGTDYKESVSR
VMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYRDQSEIGNYDSTLLQSDYTGLFRD
RTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISVGQIYYFTESRTGDDNINWENNDTT
GSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATGNGTIEYRRDENRLVQLNYRYASPEY
IQATLPSYSTAAQYKQGISQVGMTASWPIVDRWSVVGAYYYDTNTRKAANQMLGVQYNSC
CYAIRLGYERKVNGWNSNDNGGESKYDNTFGINIELRGLSSNYGLGTQQMLRSNILPYQS
SL
Sequence length782 AA
FragmentNo
pHHM coverage99.74 %
Cross-references
UniprotC4T9I0
PDB5IV8 | 5IV9
PfamPF04453 | PF03968
EMBLCP026178 | CP026392 | AB373949 | UJWM02000001 | FO834906 | VTUL01000004 | VWRA01000013 | VWRE01000014 | LEUQ01000007 | WMJQ01000004 | WNPA01000008 | WULK01000018 | JAAKYR010000005 | JAALJK010000060 | NBSD01000018 | NBIK01000006 | CP043047 | CP039828 | QOHW01000006 | NTHY02000043 | MPYG04000224 | RDAM01000001 | QFMF01000002 | SGOL01000011 | UAWQ01000019 | UFBE01000007 | UGKT01000001 | UGLB01000003 | UGLC01000002 | UGMG01000001 | UIVN01000005 | UIYB01000005 | UJGH01000005 | UJGS01000001 | UJOM01000007 | UJRJ01000005 | UJUD01000008 | UKYO01000007 | STEC01000003 | VIAJ01000002 | QYOP01000001 | SUOY02000004 | UNZU01000006 | UWVV01000001 | UWXT01000001 | CAAGTI010000006 | CAAGVF010000013 | CAAGWD010000004 | CAAGXU010000006 | CAAGZV010000010 | CAAHAF010000005 | CAAHCC010000007 | FLXF02000005
InterProIPR020889 | IPR007543 | IPR005653
Signal peptide annotation
Amino acids1-24
Sequence

MKKRIPSLLATMIASALYSQQGLA
Annotation sourceExperimentally verified
TM annotation
# beta strands26
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII
IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMOOOO
OMMMMMMMMMIIIIIIMMMMMMMMOOOOOOMMMMMMMMIIIMMMMMMMMMOOOOOOOOOO
OOOOOOOOOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOMMMMM
MMMMIIIMMMMMMMMOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIMMMMMMMMOOOOOO
OOOOOOOOOOMMMMMMMMIIIIIIIIMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOO
OOMMMMMMMMIIIIIIIIIIIIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOO
OOOOOOOOOOOOOMMMMMMMIIIIIIIIIIIIIMMMMMMMOOOOOOOOOOOOOOOOOOOO
OOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOO
OOOOOOOOOOOOOOOOOOOMMMMMMMIIIIIIIIMMMMMMMOOOOOOOOMMMMMMMIIII
IIIMMMMMMMOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIIIIIIIIIIIIIIII
II
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen