Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1055772::      
Protein information
OMPdb FamilyThe Carbapenem resistance-associated outer membrane protein (carO) Family
Protein descriptionCarO
Gene nameName=carO, ORFNames=A7M90_09860, AB571B5_03368, AB901B6_03082, ABCAM1_2813, CPI82_02360, CSB70_2700, DLI75_11130, DOL94_08915, DVA69_04705, E5294_04795, EA667_004680, EA685_12505, EA746_012195, F4U04_00910, FD887_02575, FGL68_06395, FJU36_00465, FJU76_00685, G3N47_03845, GFL19_04470, IX87_09355, NCTC13305_03380, SAMEA104305318_01037, SAMEA104305351_03217
SpeciesAcinetobacter baumannii
NCBI taxonomy470
Protein sequence

MKVLRVLVTTTALLAAGAAMADEAVVHDSYAFDKNQLIPVGARAEVGTTGYGGALLWQAN
PYVGLALGYNGGDISWTDDVSVNGTKYDLDMDNNNVYLNAEIRPWGASTNPWAQGLYIAA
GAAYLDNDYDLAKRIGNGDTLSIDGKNYQQAVPGQEGGVRGKMSYKNDIAPYLGFGFAPK
ISKNWGVFGEVGAYYTGNPKVELTQYNLAPVTGNPTSAQDAVDKEANEIRNDNKYEWMPV
GKVGVNFYW
Sequence length249 AA
FragmentNo
pHHM coverage97.35 %
Cross-references
UniprotA6XB80
PDB4RL9
EMBLDQ309875 | FJ652386 | FJ652396 | CP009257 | KP658473 | CP027178 | CACSHE010000025 | CACSGY010000013 | VYJB01000001 | WGGS01000037 | VYSO01000001 | WIGZ01000003 | JAAGTS010000002 | LYKI01000068 | NXDV01000001 | QKWF01000084 | CP039930 | CP044356 | QPHP01000005 | RFDJ01000015 | UFMQ01000003 | UFNX01000014 | UFSC01000003 | SRZJ01000028 | RFBA02000001 | VAGE01000002 | VHFD01000003 | VHGX01000001
InterProIPR011250
Signal peptide annotation
Amino acids1-21
Sequence

MKVLRVLVTTTALLAAGAAMA
Annotation sourceExperimentally verified
TM annotation
# beta strands8
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMOOOMMMMMMMIII
IIMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMIIIIIIIIIIIIMMMMM
MMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMII
IIIIIIMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
MMMMMMIII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen