Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 1054155::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe COG4313 Family
Protein descriptionProtein involved in meta-pathway of phenol degradation-like protein
Gene nameOrderedLocusNames=Pput_2725
SpeciesPseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
NCBI taxonomy351746
Protein sequence

MKQLRYLMLAAAVPSVCVQAFEVDPGDYEALPVGATIGVVYYQHSTTDSAYANGHKVSSD
FKLTSNVGILRLLHVYQLTDRLTLEPQFLLPFGRVSSSGDASALGDTSGVGDLTLTAPLK
YRLNEANDILGATVYLTAPTGNYNRDDALNLGENRWKVDLQAAYVKHLGEKWAVDLVGDA
IWYSDNDDFGSSSARREQDVSYGAQLMGRYIVDPGTSLAIGLGHTWGGENQIDGTAQDDR
AETTNFRVTANKFFTAKDQLQMQLGRDLAVENGPKENFRLNLRYVRVF
Sequence length288 AA
FragmentNo
pHHM coverage97.51 %
Cross-references
UniprotA5W3Z9
PDB4RL8
PfamPF13557
EMBLCP000712
InterProIPR025737
Signal peptide annotation
Amino acids1-20
Sequence

MKQLRYLMLAAAVPSVCVQA
Annotation sourceExperimentally verified
TM annotation
# beta strands12
Protein topology

IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMMOOOOOOOOOOOOO
OOMMMMMMMMMMMMIIIIIIIIIMMMMMMMMMMMMMOOOOOOOOOMMMMMMMMMMMMMMM
MIIIIIIMMMMMMMMMMMMMMMMOOOOOOMMMMMMMMMMMMMMMMMMMIIIMMMMMMMMM
MMMMMMOOOOOOOOOOOMMMMMMMMMMMMMMIIIIMMMMMMMMMMMMMOOOOOOOOOOOO
MMMMMMMMMMMMIIIIIIMMMMMMMMMMMMOOOOMMMMMMMMMMMMII
Annotation reliability100.00
Annotation sourceExperimental [3D-structure]


Elixir UTH dib compgen