Browse Text search Protein search Domain search Download User manual Related links Citation & Contact


::OMPdbID 77436::      
FASTA  TEXT  XML  
Protein information
OMPdb FamilyThe General Bacterial Porin (GBP-1) Family 1
Protein descriptionOmpF porin
Gene nameName=ompF, ORFNames=NCTC10005_05711, SAMEA2054040_03569
SpeciesEnterobacter cloacae
NCBI taxonomy550
Protein sequence

MMKRNILAVVVPALLVAGAANAAEIYNKDGNKLDLYGKAVGLHYFSDNDGNDGDKTYARL
GFKGETKINDQLTGYGQWEYNFQGNNSEGADAQSGNKTRLAFAGLKFGDAGSFDYGRNYG
LVYDAIGITDMLPEFGGDTGVSDNFFSGRTGGLATYRNSGFFGLVDGLNFGVQYLGKNER
TDALRSNGDGWATSLSYDFDGFGIVGAYGAADRTNAQQNLQWGKGDKAEQWATGLKYDAN
NIYLAALYGEMRNAARLDNGFANKTQDFSVVAQYQFDFGLRPSIAYYKSKAKDVEGIGDE
DYINYIDIGATYYFNKNMSTYVDYQINQLKDDNKLGINNDDTVAVGLVYQF
Sequence length351 AA
FragmentNo
pHHM coverage100.00 %
Cross-references
UniprotA0A0M7H8A9
PDB6ENE
PfamPF00267
EMBLUGJB01000004 | UOUG01000011
InterProIPR033900 | IPR023614 | IPR001897 | IPR001702 | IPR013793
PROSITEPS00576
PRINTSPR00183 | PR00182
Signal peptide annotation
Amino acids1-22
Sequence

MMKRNILAVVVPALLVAGAANA
Annotation sourceExperimentally verified
TM annotation
# beta strands16
Protein topology

IIIIIIIIIIIIIIIIIIIIIIMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOMM
MMMMIIIIIIIIIMMMMMMMMMMMMMOMMMMMMMMMMMMMMMMMMMMIIMMMMMMMMMMO
OOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMIIIIMMMMMMMOOOOOOOOOO
OOOOOOOOOOOMMMMMMMIIIMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMII
IMMMMMMMMOOOOOOOOOOOOOOOOOOOOMMMMMMMIIIMMMMMMMMOOOOOOOOOOOOO
OOOOOMMMMMMMIIIIIMMMMMMMMOOOOOOOOOOOOOOOOOMMMMMMMMI
Annotation reliability100.00
Annotation sourceHomology to 3D-structure


Elixir UTH dib compgen